PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0129839.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family MYB
Protein Properties Length: 340aa    MW: 37755.9 Da    PI: 5.0792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0129839.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.88.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd + + +v  +G g+W++++++ g++R++k+c++rw +yl
  Lj0g3v0129839.1 14 RGLWTPEEDAKMLAYVSNHGIGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding46.58.5e-1570110446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +T++E+el+++++   G++ W++Ia++++ gRt++++k++w++
  Lj0g3v0129839.1  70 FTPQEEELIINLHGAIGSR-WSLIAKRLP-GRTDNDVKNYWNT 110
                      9******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.681965IPR017930Myb domain
SuperFamilySSF466892.38E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-121363IPR001005SANT/Myb domain
PfamPF002491.3E-141461IPR001005SANT/Myb domain
CDDcd001672.24E-101761No hitNo description
Gene3DG3DSA:1.10.10.609.5E-2465116IPR009057Homeodomain-like
SMARTSM007171.7E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129417.42466116IPR017930Myb domain
CDDcd001676.66E-1170112No hitNo description
PfamPF002492.2E-1370110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPE EDAKMLAYVS NHGIGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDGF TPQEEELIIN LHGAIGSRWS LIAKRLPGRT DNDVKNYWNT KLRKKLMKMG  120
IDPVTHKPVS QVLSDYGTVS GLPSTENQMS FVNKEDLMSN MSMVEHTEED QAHSWEHQVQ  180
YQVMNPENVQ PHVFSEAASS SSSSSSSNLT QLCSPPQSYS CQTSQTQIIA PPCSSFDWSE  240
FLQCDPFVWS EFQQLQQCEL EKVMSSLSST GQIENGVEPS NNVNSNSNGQ DKQGAAGEGY  300
GAVACEGHSS SGNSFVDGIL DRDSEIRAAF PELLDASFDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-42AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003543842.21e-163PREDICTED: transcription factor MYB35-like
RefseqXP_007151175.11e-164hypothetical protein PHAVU_004G024200g
TrEMBLA0A151RUI01e-168A0A151RUI0_CAJCA; Myb-related protein Zm38
STRINGGLYMA13G04920.11e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-85MYB family protein